PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK29476.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 581aa    MW: 64743.8 Da    PI: 4.6955
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK29476.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS441.94.5e-1352115812374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                ++lL++cA  +s+g+  +a+ ++++l++++s +g+p qR+aay++e+Laar+a+s++ lykal+++e +   +s++laa+++++ev+P++kf++++aN a
  PK29476.1 211 RQLLIDCAALLSEGNIGEASVMINQLRQMVSVEGEPSQRIAAYMVEGLAARVASSGKFLYKALKCKEPP---TSDRLAAMQILFEVCPCFKFGFMAANGA 307
                689*****************************************************************9...9*************************** PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                I ea++ e++vHi+Dfdi+qG Q+++L+q++a sR+++ p+lR+Tgv++pes+  s   l+ +g+ L+k Ae lgvpf+f++ va+r++ +++++L+++p
  PK29476.1 308 IIEAFKDEKTVHIVDFDINQGSQYMTLIQKIAaSRKGKIPQLRLTGVDDPESVqrSVGGLKIIGQMLEKRAEDLGVPFKFQA-VASRTSLVTPSMLDCRP 406
                *******************************989*****************9989999************************.7**************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                gEal+Vn+++qlh+++desvs+ +erd++L++vksl+Pk+v+vveq++++n+++F+ rf+ea +yysa+f+sl+a+lpres +r++vEr++l+r+ivn++
  PK29476.1 407 GEALVVNFAFQLHHMPDESVSTINERDQLLRMVKSLNPKLVTVVEQDVNTNTSPFFPRFIEAYKYYSAVFESLDATLPRESPDRTNVERQCLARDIVNII 506
                **************************************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                aceg+er+er e ++kWr+r+++aGF++ p+s++++++++ l+r++ ++ y++++e g+l++gW+d++L+++S+Wr
  PK29476.1 507 ACEGEERIERYEVAGKWRARMTMAGFTSCPMSSNVVDSIRELIRQYCDR-YKIKDEMGALLFGWEDKSLIVASSWR 581
                ***********************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.022184562IPR005202Transcription factor GRAS
PfamPF035141.6E-132211581IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MSLVRPAELS ATSYRNPKLY SLKGSSTDSS AFSTQTFGSE KRKTLYVTDS YSNESYEKYF  60
LDSPSDEIQQ PSCSSASGNS YNPQDASCYQ PRAGSSVSHL TTHNNPCDAS FMSIGDFESD  120
YLESSSPELG DFDKSTMRLK LQELERVLLN DNDDDNDGDE DMEVDVDWVG PVQSGLLNDS  180
PKESSSSDYS YLSSISSSNK EISQVSHRSP RQLLIDCAAL LSEGNIGEAS VMINQLRQMV  240
SVEGEPSQRI AAYMVEGLAA RVASSGKFLY KALKCKEPPT SDRLAAMQIL FEVCPCFKFG  300
FMAANGAIIE AFKDEKTVHI VDFDINQGSQ YMTLIQKIAA SRKGKIPQLR LTGVDDPESV  360
QRSVGGLKII GQMLEKRAED LGVPFKFQAV ASRTSLVTPS MLDCRPGEAL VVNFAFQLHH  420
MPDESVSTIN ERDQLLRMVK SLNPKLVTVV EQDVNTNTSP FFPRFIEAYK YYSAVFESLD  480
ATLPRESPDR TNVERQCLAR DIVNIIACEG EERIERYEVA GKWRARMTMA GFTSCPMSSN  540
VVDSIRELIR QYCDRYKIKD EMGALLFGWE DKSLIVASSW R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-5122758120375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104285.10.0hypothetical protein L484_005388
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLW9RNG00.0W9RNG0_9R
STRINGPOPTR_0002s07430.10.0(Populus trichocarpa)
STRINGPOPTR_0005s20890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49883457
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1